PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.1G065300.1.p
Common NameLOC101766953, SETIT_017487mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family CO-like
Protein Properties Length: 387aa    MW: 39459.1 Da    PI: 6.7652
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.1G065300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.27.2e-0855100342
            zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                          ++C+ +e+ ++   C+ +   lC+ C   +H        H++vp+
  Seita.1G065300.1.p  55 VWVCEVCERAPAAVTCRADAAALCAACDADIHDAnplarrHERVPV 100
                         689*****************************44788888999986 PP

2CCT713e-24290333144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         Rea+l+RY+eKrk+R+FeK+irY+sRKa+AesRpRvKGrF+k+a
  Seita.1G065300.1.p 290 REARLMRYREKRKNRRFEKTIRYASRKAYAESRPRVKGRFAKRA 333
                         9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.00351257IPR000315B-box-type zinc finger
PROSITE profilePS5011910.86553100IPR000315B-box-type zinc finger
PfamPF006438.4E-654100IPR000315B-box-type zinc finger
SMARTSM003367.9E-958100IPR000315B-box-type zinc finger
PfamPF062036.1E-18290332IPR010402CCT domain
PROSITE profilePS5101716.986290332IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MEVGLAARYW GVGGRRCGAC GGSPAAVHCR TCPGGGAYLC AGCDAGHAAA GHERVWVCEV  60
CERAPAAVTC RADAAALCAA CDADIHDANP LARRHERVPV QPIGAAAAPH AADPMLFVAA  120
AAVGEKDDDA AAAGMLGGAA KVDAKQLEFL FAEVMDPFLG QEEFARFPHA DSVVPNNGSS  180
GGALDLDFGG GVAAGAAKPS YSSYTAASVA HSGSSSEVGL VPDAICGRGG SVTGGVIELD  240
FAQSKAAYLP YAATPTHSVS SLNVGAVPER GDGGVMAGRV AVATAAGESR EARLMRYREK  300
RKNRRFEKTI RYASRKAYAE SRPRVKGRFA KRADDNDADA AAADDFVTSS TAAAPPPPQQ  360
QQPAAYPSYV LNFSPAAAGY GVVPTF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3672193e-68AK367219.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2053C02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951711.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5-like
TrEMBLK3YT920.0K3YT92_SETIT; Uncharacterized protein
STRINGSi017487m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.13e-29CONSTANS-like 5